PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0093s0071.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 518aa    MW: 56834.1 Da    PI: 7.4617
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0093s0071.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.94.4e-33193249259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          dDgynWrKYGqK+vkgse+prsYY+Ct++gCp+kkkvers  d++++ei+Y+g+Hnh 
  Kalax.0093s0071.1.p 193 DDGYNWRKYGQKQVKGSENPRSYYKCTFPGCPTKKKVERSL-DGDITEIVYKGSHNHA 249
                          8****************************************.***************7 PP

2WRKY105.72.4e-33362420159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+++d ++v++tYeg+Hnh+
  Kalax.0093s0071.1.p 362 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERASHDLRAVITTYEGKHNHD 420
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-29183251IPR003657WRKY domain
SuperFamilySSF1182901.44E-25186251IPR003657WRKY domain
PROSITE profilePS5081124.03187251IPR003657WRKY domain
SMARTSM007744.7E-36192250IPR003657WRKY domain
PfamPF031063.4E-25193248IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-37347422IPR003657WRKY domain
SuperFamilySSF1182902.62E-29354422IPR003657WRKY domain
PROSITE profilePS5081138.377357422IPR003657WRKY domain
SMARTSM007743.1E-39362421IPR003657WRKY domain
PfamPF031068.0E-26363420IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MAASSANSPF SLSPSFMNNS FSDLLNSPAA VAPGDDSTLL NGSVNRGAPK FKSLHPPSLL  60
PVSPTPASPS SYFAFPPGLS PSELLDSPVL LTSSYLLPSP TTGSFPAAQP HNWSVSGQHD  120
VKPEDSRNQN NTSSYSDFTF QPELRTVSQQ PWNFKSYQSQ QKTDSISNER VSGDYSSYQP  180
APIQSVREAR RSDDGYNWRK YGQKQVKGSE NPRSYYKCTF PGCPTKKKVE RSLDGDITEI  240
VYKGSHNHAK PQSTRRSASN GSHPMQHVNG ELQAQEHSVG SQMVANQLSD HSAATPENSS  300
VSVGDDDRSS SRRVGDDKLD DDEPDHKRWK RENEGEIMSA PGCRAVREPR VVVQTTSDID  360
ILDDGYRWRK YGQKVVKGNP NPRSYYKCTN PGCPVRKHVE RASHDLRAVI TTYEGKHNHD  420
VPAARGSGSH SRQAAANNSC VTNSTHHQSS TGQPATAQQA PFTLEMLHGP ESFGFGNPVS  480
AYNNVNGRQQ NPDCSVFPRT KEEPREDQFL ESICYAD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-37183423878Probable WRKY transcription factor 4
1wj2_A2e-37183423878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0539942e-54BT053994.1 Zea mays full-length cDNA clone ZM_BFc0103O21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142085.11e-173hypothetical protein PHAVU_008G251300g
SwissprotQ8S8P51e-109WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLV7B8C11e-173V7B8C1_PHAVU; Uncharacterized protein
STRINGGLYMA14G38010.11e-168(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-101WRKY DNA-binding protein 33